PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj1g3v3218010.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family WOX
Protein Properties Length: 256aa    MW: 28790.1 Da    PI: 5.3946
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj1g3v3218010.2genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.14.8e-2184144257
                      T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
         Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                      r+R+t+t+ ql++Le+ Fe  + +ps+e+++e+++ l    +++e++V++WFqNrRa+ k+
  Lj1g3v3218010.2  84 RQRWTPTAVQLQILERIFEAgTGTPSKEKIKEITADLsqhgQISETNVYNWFQNRRARSKR 144
                      89*****************99**************************************97 PP

2Wus_type_Homeobox102.43.1e-3383146265
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        +r+RWtPt+ Q++iLe+++++G+ tP+ke+i++ita L+++G+i+++NV++WFQNr+aR+++kq
    Lj1g3v3218010.2  83 SRQRWTPTAVQLQILERIFEAGTGTPSKEKIKEITADLSQHGQISETNVYNWFQNRRARSKRKQ 146
                        689***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.6E-1778148IPR009057Homeodomain-like
PROSITE profilePS5007114.73880145IPR001356Homeobox domain
SMARTSM003892.6E-1482149IPR001356Homeobox domain
SuperFamilySSF466894.71E-1882149IPR009057Homeodomain-like
PfamPF000467.6E-1984144IPR001356Homeobox domain
CDDcd000861.31E-1384146No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MVMEWQKQQQ QQQQRWIPNT NANLMTDEQV ETLRKQIAVY STICEQLIDM HKTLSTHQDL  60
AGVRLGGMYC DPLMASGGHK ISSRQRWTPT AVQLQILERI FEAGTGTPSK EKIKEITADL  120
SQHGQISETN VYNWFQNRRA RSKRKQQSVS QPSGANAESE VETEVDSKDK KTKSGEVVVQ  180
PTAENMCFQN PDVCPDLQYL SPESDGGLRS TRGFDHVPSF DGMLSSSRSG YLTEKMEAPE  240
SYNLYQPAGG DYDMSG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1137145RRARSKRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00669PBMTransfer from GRMZM2G038252Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004492097.11e-131PREDICTED: WUSCHEL-related homeobox 13-like
SwissprotO817887e-79WOX13_ARATH; WUSCHEL-related homeobox 13
TrEMBLA0A0B2Q1N91e-127A0A0B2Q1N9_GLYSO; WUSCHEL-related homeobox 13
TrEMBLK7MVC21e-127K7MVC2_SOYBN; Uncharacterized protein
STRINGGLYMA18G52491.11e-126(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35550.16e-80WUSCHEL related homeobox 13